PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01542.1.p
Common NameEUGRSUZ_K01542, LOC104425308
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 358aa    MW: 39212.6 Da    PI: 9.6537
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01542.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-1798143147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg W + Ed +l+d+v ++G+ +W++Ia++++ gR++k+c++rw++ 
  Eucgr.K01542.1.p  98 RGHWRPAEDAKLKDLVSRFGPQNWNLIAEHLQ-GRSGKSCRLRWFNQ 143
                       899*****************************.***********996 PP

2Myb_DNA-binding52.51.1e-16150193146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r+++ +eE+++l+ a+k +G++ W+ Iar ++ gRt++ +k++w+ 
  Eucgr.K01542.1.p 150 RKAFNEEEEDRLLAAHKAYGNK-WAMIARLFP-GRTDNAVKNHWHV 193
                       7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.30493144IPR017930Myb domain
SMARTSM007178.2E-1497146IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2898191IPR009057Homeodomain-like
PfamPF002492.5E-1698143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2699151IPR009057Homeodomain-like
CDDcd001675.37E-13101142No hitNo description
PROSITE profilePS5129424.792145199IPR017930Myb domain
SMARTSM007172.3E-14149197IPR001005SANT/Myb domain
PfamPF002493.4E-13150192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19152197IPR009057Homeodomain-like
CDDcd001673.80E-11152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MSTQHLKSSA GGLSLSYKFG RLDHREPENP DMGLQILSPS WERAEKLVAI QKPNARNGCI  60
LGLETRGSVL VFSGEAEEQK TQSLCAKSGG GHTKLCARGH WRPAEDAKLK DLVSRFGPQN  120
WNLIAEHLQG RSGKSCRLRW FNQLDPRINR KAFNEEEEDR LLAAHKAYGN KWAMIARLFP  180
GRTDNAVKNH WHVIMARRQR EQSNVYRKRK PPSHLRHRPD QHDHQHAQAL PKGLDPSSST  240
TLSSNVDESD STCTDLSLTP SSAMSSPPFF SGSSGKTAAV DNVTSDKSSL TRNGFHFPGP  300
GVINPGGLDY HHQHHNSGSS SDSNSEVSAP ESVAAPTTNS NKMSPPSFID FLGVGST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32981987107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01542.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036268.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A059A2380.0A0A059A238_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s05740.12e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.13e-69myb domain protein 56